top of page

CircRNA

Gene

chr6|43178882|43179066|+|1|ciRNA|SRF|NM_003131|6

SRF

CircRNA UID

ciSRF(6)

Open Reading Frame (ORF)

LTLGDPVTSSSKPKSLAWKPICFSAQACGWQAGKPGEPELAGQSLRR

Peptide

LTLGDPVTSSSKPK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page