top of page

CircRNA

Gene

chr6|42632551|42637194|+|4|circRNA|UBR2|NM_015255|12,13,14,15

UBR2

CircRNA UID

circUBR2(12,13,14,15)

Open Reading Frame (ORF)

LMQCHGGYTDGEQPITLSICGHSVETIRYCVSQEKVSIHLPVSRLLAGSNAHHRRKLNEHYH

Peptide

LLAGSNAHHRR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page