top of page

CircRNA

Gene

chr6|42612170|42617507|+|4|circRNA|UBR2|NM_001184801|8,9,10,11

UBR2

CircRNA UID

circUBR2(8,9,10,11).A

Open Reading Frame (ORF)

MTTTESFQSQTSRFRYSRFLHLEIPVDRQSHSKFKLCIRLLSHIRILV

Peptide

QSHSKFK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page