top of page

CircRNA

Gene

chr6|4031558|4032755|+|1|circRNA|PRPF4B|ENST00000480058.5|2

PRPF4B

Open Reading Frame (ORF)

LVWGSFCKVMSLALKKRGKFMKRQEMEIGLVLDLQVQRGNLNLWTIKLLQRNEVKADPKNGLDIGLIKRKVRGVLKSLKRKQLGASQRRGKNLKAHPKEVSLKIKQGNQNPLPLEGDLKRKLVRPDLLLMIRLKLKIKVNQKIGKNPQL

Peptide

QLGASQRR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page