top of page

CircRNA

Gene

chr6|3006467|3012674|+|3|circRNA|NQO2|ENST00000380472.7|3,4,5

NQO2

CircRNA UID

circNQO2(3,4,5)

Open Reading Frame (ORF)

LRFSIMEWKPTKPTSKGLWLATSLMSRKRFGRLT

Peptide

GLWLATSLMSR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page