top of page

CircRNA

Gene

chr6|25472426|25540078|+|16|circRNA|LRRC16A|ENST00000329474.6|11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26

LRRC16A

CircRNA UID

circLRRC16A(11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26)

Open Reading Frame (ORF)

LLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRVVDEQLKRFCTKTGQCSST

Peptide

TGQCSST

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page