top of page

CircRNA

Gene

chr6|24563358|24572698|-|6|circRNA|KIAA0319|ENST00000430948.6|15,14,13,12,11,10

KIAA0319

CircRNA UID

circKIAA0319(15,14,13,12,11,10)

Open Reading Frame (ORF)

LVELTLQVGVGQLTEQRKDTLVRQLAVLLNVLDSDIKVQKIRAHSDLREYRRHTFIYLQCRKEIIHFS

Peptide

HTFIYLQCR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page