top of page

CircRNA

Gene

chr6|17833960|17855617|—|7|circRNA|KIF13A|ENST00000378814.9|12,11,10,9,8,7,6

KIF13A

Open Reading Frame (ORF)

MKAPELKEKLEESEKLIKELTVTWEEKLRKTEEIAQVRENPFP

Peptide

KTEEIAQVR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page