top of page

CircRNA

Gene

chr6|169769539|169779295|+|6|circRNA|ERMARD|ENST00000366772.6|12,13,14,15,16,17

ERMARD

Open Reading Frame (ORF)

LSPVLSLILLLIALELVNIHAVCGKNAHEYQQYLKNFSGIS

Peptide

NAHEYQQYLKNFSGIS

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page