top of page

CircRNA

Gene

chr6|165379193|165392796|—|3|circRNA|PDE10A|ENST00000366882.5|19,18,17

PDE10A

Open Reading Frame (ORF)

MSRCLRSSAKPSLPQTLLYTLETGSSWKRCTRPDH

Peptide

CLRSSAKPSLPQTLLYTLETGSSWK

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page