top of page

CircRNA

Gene

chr6|161165576|161166417|-|2|circRNA|AGPAT4|ENST00000436279.1|3,2

AGPAT4

Open Reading Frame (ORF)

LSLCHIAESESSAVLRAGDAAGVVVGHGMHHLHGPARLPQVWEGKCHRGSQPQV

Peptide

AGDAAGVVVGHGMHHLHGPARLPQVWEGK

ORF Found in Long-Read

false

Peptide Length

29

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

29

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page