top of page

CircRNA

Gene

chr6|160046497|160048543|+|4|circRNA|IGF2R|NM_000876|15,16,17,18

IGF2R

Open Reading Frame (ORF)

LAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQGFLLTYHLSQRKMVPIKLRQRSMTFI

Peptide

QRSMTFI

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page