top of page

CircRNA

Gene

chr6|159784665|159785496|—|2|circRNA|TCP1|NM_001008897|5,4

TCP1

Open Reading Frame (ORF)

MVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGKQCVISMKT

Peptide

SQMESMLISGYALNCVVGSQGK

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page