top of page

CircRNA

Gene

chr6|158725502|158763509|+|7|circRNA|SYTL3|ENST00000360448.7|12,13,14,15,16,17,18

SYTL3

Open Reading Frame (ORF)

LPDQQKLRLKSPVLRKQACPQWKHSFVFSGVTPAQLRQSSLELTVWDQALFGMNDRLLGGTRLGSKGQCTRYSETSQSRGSQMLY

Peptide

LGSKGQCTR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page