top of page

CircRNA

Gene

chr6|158501677|158504178|+|1|circRNA|TULP4|ENST00000367097.7|13

TULP4

Open Reading Frame (ORF)

LPAPLPLSKQAMGWECHIQEAITTPLCLECRLPALPKMPCPQRSLHNRSLLWSFSRCTHPASPIAPCPPCTQEAARALVYSCHLSPCIHGVPTAPARPCRTPRALSPQSHTWWWRSPLCPHHLPTSKATWAQR

Peptide

MPCPQRSLHNR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page