top of page

CircRNA

Gene

chr6|158452133|158461729|+|2|circRNA|TULP4|ENST00000367097.7|5,6

TULP4

Open Reading Frame (ORF)

MFVGSTSSHWTLSCRWSGSISHPSAEHQASAHRQLHLGRHQLNEQLR

Peptide

QLHLGRHQLNEQLR

ORF Found in Long-Read

true

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page