top of page

CircRNA

Gene

chr6|158081108|158081510|+|2|circRNA|SYNJ2|NM_003898|19,20

SYNJ2

CircRNA UID

circSYNJ2(19,20)

Open Reading Frame (ORF)

LCWRSWRWKFRKSMWVLGRGFSRKCPPSRAPWMPLL

Peptide

SMWVLGRGFSR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page