top of page

CircRNA

Gene

chr6|152206167|152208206|-|2|circRNA|SYNE1|NM_033071|125,124

SYNE1

Open Reading Frame (ORF)

LWRLASNSFSRRTVALRPPCRPNSLKSKRNGNQPACGWKNRRKN

Peptide

LASNSFSRR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page