top of page

CircRNA

Gene

chr6|151417278|151445825|—|9|circRNA|RMND1|NM_017909|10,9,8,7,6,5,4,3,2

RMND1

Open Reading Frame (ORF)

LISTGTEKTWKDFTIKRVNSLALAEELSLGCGNASHTPQSRGQISSYIIKSTSVPKNRSSNVKTT

Peptide

LISTGTEK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page