top of page

CircRNA

Gene

chr6|151348710|151353752|+|1|circRNA|AKAP12|ENST00000402676.6|4

AKAP12

CircRNA UID

circAKAP12(4)

Open Reading Frame (ORF)

LERNRKGKEEEETRNQGSTLRFQPILRTARRSKRARALPHPLRSPRRSRVWKRA

Peptide

ALPHPLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

true

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page