top of page

CircRNA

Gene

chr6|149738642|149742570|—|2|circRNA|NUP43|ENST00000340413.6|5,4

NUP43

Open Reading Frame (ORF)

LKIWDFRQQGNEPSQILSLLCQSTSSGLQLTTTQALAVLPIAVHHVQVLCATTQKSLQLERMVE

Peptide

SLQLERMVE

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page