top of page

CircRNA

Gene

chr6|149342684|149370099|+|2|circRNA|TAB2|NM_015093|3,4

TAB2

Open Reading Frame (ORF)

MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQAPDPVPGPALEKKYPVEMSSLQLLN

Peptide

YPVEMSSLQLLN

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page