top of page

CircRNA

Gene

chr6|143765260|143765798|+|1|circRNA|PHACTR2|ENST00000367584.8|5

PHACTR2

CircRNA UID

circPHACTR2(5)

Open Reading Frame (ORF)

MLAPLIQKKQLALKHQLRHPLHPPHLVPKLQRRQFLAKQGQWGPPRAREKLTSSQ

Peptide

MLAPLIQKK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page