top of page

CircRNA

Gene

chr6|138441982|138496371|—|3|rescued|NHSL1|ENST00000343505|107,87,153|0,31364,54236

NHSL1

Open Reading Frame (ORF)

MRKADGQSTTLPRGTSRRMCSFPPQDPPVLRTCTAKPSSTSNQY

Peptide

KADGQSTTLPR

ORF Found in Long-Read

true

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Rescued

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page