top of page

CircRNA

Gene

chr6|136277864|136282687|—|3|circRNA|BCLAF1|ENST00000353331.8|4,3,2

BCLAF1

Open Reading Frame (ORF)

LNMTHLSLSMNLISHQPHPVIFGLAFQLMIIVLDHPIVLHLLLHHLVRVHLALMLPCSVQFTLQKILLLSIHIPFSIVLKGLGLVLLEMDLVDTVLLRIVQFITSLHEEVLQRQSHHRMLQEMSLGAVPRFILMVEIRKLQRLGSS

Peptide

GLGLVLLEMDLVDTVLLR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page