top of page

CircRNA

Gene

chr6|136269436|136275989|—|5|circRNA|BCLAF1|NM_001077441|9,8,7,6,5

BCLAF1

Open Reading Frame (ORF)

LLTFGMTLIAVEKKEVKNGEIPRAPGNPVDQESRKKLQKITRNTNLTKMTVPLYTRIWMHEKSLPSERKAHLGSK

Peptide

APGNPVDQESR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page