top of page

CircRNA

Gene

chr6|131145284|131165217|+|3|circRNA|AKAP7|ENST00000431975.6|2,3,4

AKAP7

CircRNA UID

circAKAP7(2,3,4)

Open Reading Frame (ORF)

LQNAIIQQDERLAKAMVSDGSFHITLLVMQLLNEDEVNMRN

Peptide

AMVSDGSFHITLLVMQLLNEDEVNMR

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page