top of page

CircRNA

Gene

chr6|130885095|130904540|—|7|circRNA|EPB41L2|ENST00000528282.5|12,11,10,9,8,7,6

EPB41L2

Open Reading Frame (ORF)

MDQSLMKDFPGAAGEISAYGPGLVSIAVVQDGDGRREVRSPTKAPHLQLIEGKTFHGYSLLM

Peptide

APHLQLIEGKTFHGYSLLM

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page