top of page

CircRNA

Gene

chr6|129049917|129192853|+|11|circRNA|LAMA2|ENST00000617695.4|2,3,4,5,6,7,8,9,10,11,12

LAMA2

CircRNA UID

circLAMA2(2,3,4,5,6,7,8,9,10,11,12)

Open Reading Frame (ORF)

LTFLAAFEWLPSRTTWTHLSRSASVTRRPGKPCRTATTGARRLPIWETKFIPCCPESCF

Peptide

TATTGAR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page