top of page

CircRNA

Gene

chr6|127807215|127901081|-|5|circRNA|THEMIS|NM_001164685|5,4,3,2,1

THEMIS

CircRNA UID

circTHEMIS(5,4,3,2,1)

Open Reading Frame (ORF)

LQLQTSVTQKPQVSVSTRSTNYPRHSNGIITGRIRPLP

Peptide

HSNGIITGR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page