top of page

CircRNA

Gene

chr6|119002898|119024813|—|9|circRNA|FAM184A|ENST00000621231.4|10,9,8,7,6,5,4,3,2

FAM184A

Open Reading Frame (ORF)

MMSMNLQFKPSKMLMKKKFNKFLLKQEKKYCSIKAK

Peptide

MMSMNLQFKPSK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page