top of page

CircRNA

Gene

chr6|117566853|117569736|—|2|circRNA|RP1—179P9.3|ENST00000467125.1|4,3

RP1-179P9.3

Open Reading Frame (ORF)

LQRHKWGNQSITRVGKNMVFQSSSLRSIRGNLLIDAEGCTLGMLFWQSTELT

Peptide

HKWGNQSITR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page