top of page

CircRNA

Gene

chr6|11189963|11191205|-|1|circRNA|NEDD9|ENST00000379446.9|5

NEDD9

CircRNA UID

circNEDD9(5)

Open Reading Frame (ORF)

LQNRWLEGTRACPRITHPRNSDSQWALRTTHMMSPEAFSFLSHQQKPVRKQTPRKGMVFMMSLCITRQMLKALGTWWMGSTDCLSPVQAAPGVTCPRLPPPPRSPHCQPPQLRTKGSSWIQTQLLRDFSGSSRPLRWVSPA

Peptide

KGMVFMMSLCITR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page