top of page

CircRNA

Gene

chr6|111694374|111708020|-|7|circRNA|FYN|ENST00000538466.5|9,8,7,6,5,4,3

FYN

CircRNA UID

circFYN(9,8,7,6,5,4,3)

Open Reading Frame (ORF)

MAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGKEIGGKPAP

Peptide

QGKEIGGKPAP

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page