top of page

CircRNA

Gene

chr6|109451599|109452615|—|2|circRNA|MICAL1|ENST00000456101.6|7,6

MICAL1

Open Reading Frame (ORF)

LITQHEKSWNLSEMNLCMGVLLKWYFKKVPLFTLVLHCHATRWCRSPKCHPPPSFPLCSKSSGLLGLGQMVVCVIRTRGVLCVEHSPQPKLGSQLRGQAMLGCLGKVMHYQETYLLSPALYPQALIWRTLCTTRTTPTTL

Peptide

CHPPPSFPLCSKSSGLLGLGQMVVCVIR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

28

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page