top of page

CircRNA

Gene

chr6|10935057|10956242|+|5|circRNA|SYCP2L|ENST00000341041.8|21,22,23,24,25

SYCP2L

CircRNA UID

circSYCP2L(21,22,23,24,25)

Open Reading Frame (ORF)

LPFSQPLKTSLKNGKENMRLSFYHHQRKKYPSKITPHLQRLLNKNSKIVLLF

Peptide

YPSKITPHLQR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page