top of page

CircRNA

Gene

chr6|106640348|106649201|+|4|circRNA|QRSL1|NM_018292|2,3,4,5

QRSL1

CircRNA UID

circQRSL1(2,3,4,5)

Open Reading Frame (ORF)

LEEAQVGVQLLYRRSHATRFCGTETRPNYTNRALSKMSLSYQEDQVSKCLHYCVRRGGLKTS

Peptide

LEEAQVGVQLLYR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page