top of page

CircRNA

Gene

chr6|106279660|106316266|-|4|circRNA|ATG5|ENST00000343245.7|5,4,3,2

ATG5

Open Reading Frame (ORF)

LHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNVWLWLK

Peptide

DHKQLWMGLQNVWLWLK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page