top of page

CircRNA

Gene

chr6|100589633|100638821|-|12|circRNA|ASCC3|ENST00000369162.6|36,35,34,33,32,31,30,29,28,27,26,25

ASCC3

CircRNA UID

circASCC3(36,35,34,33,32,31,30,29,28,27,26,25)

Open Reading Frame (ORF)

LKHQTVKMFKDRLKPECSTEELLSILSNYWIFSLYQSQLWDVKHMKPCTTSATLTLYRHKYFIHCITRIVMSYLEHLLDRERLLQLN

Peptide

IVMSYLEHLLDRER

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page