top of page

CircRNA

Gene

chr5|98896225|98899705|-|5|circRNA|CHD1|ENST00000614616.4|12,11,10,9,8

CHD1

Open Reading Frame (ORF)

MGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVVYLGDINSRNMLLVLLQPSMQLKQMVTQMQALKKTKNQERFSI

Peptide

NMLLVLLQPSMQLK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page