top of page

CircRNA

Gene

chr5|94909250|94912976|-|2|circRNA|MCTP1|ENST00000515393.5|10,9

MCTP1

CircRNA UID

circMCTP1(10,9)

Open Reading Frame (ORF)

MPKTLNPQWREQFDFHLYEERGGVIDITAWDKDAGKRDDFIGSFRPKVYAYQTYTENRIFGEE

Peptide

DDFIGSFRPKVYAYQTYTENR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

15

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page