top of page

CircRNA

Gene

chr5|94384367|94403793|-|5|circRNA|KIAA0825|NM_001145678|20,19,18,17,16

KIAA0825

CircRNA UID

circKIAA0825(20,19,18,17,16)

Open Reading Frame (ORF)

LLPNYLRLDKMTFSVLLKNSLNVRGVRARGHPMLETGTDRCHQGHCTADSICNEF

Peptide

GHPMLETGTDR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page