top of page

CircRNA

Gene

chr5|9108139|9122837|-|3|circRNA|SEMA5A|ENST00000382496.9|16,15,14

SEMA5A

CircRNA UID

circSEMA5A(16,15,14)

Open Reading Frame (ORF)

MNICYVPHTCSGQAGVLGNGAQPNAGVAFKLAAGSVRMGLTVQAAM

Peptide

LAAGSVR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page