top of page

CircRNA

Gene

chr5|90853283|90863857|+|4|circRNA|ADGRV1|NM_032119|80,81,82,83

ADGRV1

Open Reading Frame (ORF)

LIVAHICQYWLFTGILSKSMDTSLKERKEITFEFQRGYWMSRMQK

Peptide

LIVAHICQYWLFTGILSK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page