top of page

CircRNA

Gene

chr5|90815618|90863857|+|9|circRNA|ADGRV1|NM_032119|75,76,77,78,79,80,81,82,83

ADGRV1

Open Reading Frame (ORF)

LAVLSHIFCARYSMFAAKLLTHMMAASLGTQGVTFTMAS

Peptide

LLTHMMAASLGTQGVTFTMAS

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page