top of page

CircRNA

Gene

chr5|82310156|82312851|+|2|circRNA|ATP6AP1L|NM_001017971|8,9

ATP6AP1L

Open Reading Frame (ORF)

LSIQSWFSLRRVEIISNNSIQAVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQVVFEAW

Peptide

RVEIISNNSIQAVFNPTGVYAPSGYSYR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

28

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page