top of page

CircRNA

Gene

chr5|80146089|80175047|-|7|circRNA|SERINC5|NM_001174071|11,10,9,8,7,6,5

SERINC5

Open Reading Frame (ORF)

LYVMMTVTNWFNLALCGSRRRLPLHWHPAPPARGVCT

Peptide

LYVMMTVTNWFNLALCGSRR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page