top of page

CircRNA

Gene

chr5|79619611|79669028|+|11|circRNA|PAPD4|ENST00000453514.5|2,3,4,5,6,7,8,9,10,11,12

PAPD4

CircRNA UID

circPAPD4(2,3,4,5,6,7,8,9,10,11,12).A

Open Reading Frame (ORF)

LLYSCTLYIKLHVMFLLTSQRMNQTLGTSYWAFLNIMLQNLSRRIHVHFQ

Peptide

LHVMFLLTSQRMNQTLGTSYWAFLNIMLQNLSR

ORF Found in Long-Read

false

Peptide Length

33

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page