top of page

CircRNA

Gene

chr5|79290120|79300863|+|4|circRNA|JMY|NM_152405|3,4,5,6

JMY

Open Reading Frame (ORF)

MKWYTMTLTKAWRPCWRRKRWQHLRTYREKSCRNFSRKHASWKQDVDGFLPRNPTSEIKRFPWRMIIWDLEELRVYKKKMLIGSGKLTWLYCLFKILLSSTLK

Peptide

QDVDGFLPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page