top of page

CircRNA

Gene

chr5|78955294|78969192|-|3|circRNA|ARSB|ENST00000264914.8|4,3,2

ARSB

Open Reading Frame (ORF)

LFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDPYRFTAPNNLALSAQLCSSG

Peptide

FTAPNNLALSAQLCSSG

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page